PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_014007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family MYB
Protein Properties Length: 237aa    MW: 27831.3 Da    PI: 9.6305
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_014007genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53e-18449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l+++v+++G+++W++Ia++++ gR++k+c++rw++ 
      DCAR_014007  4 RGHWRPAEDEKLKELVERYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding50.74.3e-165699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r ++++eE++ll+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
      DCAR_014007 56 RSPFSEEEEDLLLASHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.829154IPR017930Myb domain
SMARTSM007171.8E-15352IPR001005SANT/Myb domain
PfamPF002497.7E-18449IPR001005SANT/Myb domain
SuperFamilySSF466899.36E-30497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-27557IPR009057Homeodomain-like
CDDcd001673.16E-13748No hitNo description
SMARTSM007176.7E-1555103IPR001005SANT/Myb domain
PROSITE profilePS5129420.20355105IPR017930Myb domain
PfamPF002491.7E-135698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2058104IPR009057Homeodomain-like
CDDcd001672.23E-105898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MCSRGHWRPA EDEKLKELVE RYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRSPFS  60
EEEEDLLLAS HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MARRCRERSK LYAKRAAAQT  120
LSKHDHHTKN LASLVEKYTH RFEFPLVHNY HQNLCDPQPQ SLIHNQKLHQ DKKQKVEFYD  180
FLQVRTESLR SEVTDQGKRD EEEVDQNHFS ALLAEQQKKP STVQFIDFLS AHTSAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-3341057108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006441364.11e-106hypothetical protein CICLE_v10021859mg
RefseqXP_006478100.11e-106PREDICTED: transcription factor MYB82
TrEMBLA0A067DID91e-106A0A067DID9_CITSI; Uncharacterized protein
TrEMBLV4VNT61e-106V4VNT6_9R
STRINGPOPTR_0012s03650.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.16e-84myb domain protein 52